Skip to main content
ClaudeWave

Create keyframe animations from hand-drawn Excalidraw diagrams — timeline editor, camera animation, sequence reveals, and an MCP server for AI-driven creation with real-time live preview Export as MP4, WebM, GIF, or animated SVG.

MCP Servers46 estrellas7 forksTypeScriptMITActualizado 5d ago
Install in Claude Code / Claude Desktop
Method: Manual
Claude Code CLI
git clone https://github.com/excalimate/excalimate
claude_desktop_config.json (Claude Desktop)
{
  "mcpServers": {
    "excalimate": {
      "command": "node",
      "args": ["/path/to/excalimate/dist/index.js"]
    }
  }
}
1. Run the command above in your terminal (Claude Code), or paste the JSON config into claude_desktop_config.json (Claude Desktop).
2. Replace any <placeholder> values with your API keys or paths.
3. Restart Claude. The MCP server and its tools appear automatically.
💡 Clone https://github.com/excalimate/excalimate and follow its README for install instructions.
Casos de uso

Resumen de MCP Servers

README no disponible. Visita el repo en GitHub para la documentación completa.
aiai-toolsanimationdiagramexcalidrawexcalidraw-animationgifkeyframe-animationmcpmcp-servermodel-context-protocolmotion-designmp4reacttimelinetypescriptvitewhiteboard

Lo que la gente pregunta sobre excalimate

¿Qué es excalimate/excalimate?

+

excalimate/excalimate es mcp servers para el ecosistema de Claude AI. Create keyframe animations from hand-drawn Excalidraw diagrams — timeline editor, camera animation, sequence reveals, and an MCP server for AI-driven creation with real-time live preview Export as MP4, WebM, GIF, or animated SVG. Tiene 46 estrellas en GitHub y se actualizó por última vez 5d ago.

¿Cómo se instala excalimate?

+

Puedes instalar excalimate clonando el repositorio (https://github.com/excalimate/excalimate) o siguiendo las instrucciones del README en GitHub. ClaudeWave también te ofrece bloques de instalación rápida en esta misma página.

¿Es seguro usar excalimate/excalimate?

+

excalimate/excalimate aún no ha sido auditado por nuestro agente de seguridad. Revisa el repositorio original en GitHub antes de usarlo en producción.

¿Quién mantiene excalimate/excalimate?

+

excalimate/excalimate es mantenido por excalimate. La última actividad registrada en GitHub es de 5d ago, con 12 issues abiertos.

¿Hay alternativas a excalimate?

+

Sí. En ClaudeWave puedes explorar mcp servers similares en /categories/mcp, ordenados por popularidad o actividad reciente.

Despliega excalimate en tu cloud

Lleva este repo a producción en minutos. Cada plataforma genera su propio entorno con variables de entorno editables.

¿Mantienes este repo? Añade un badge a tu README

Pega el badge en tu README de GitHub para mostrar que está auditado por ClaudeWave. Cada badge enlaza de vuelta a esta página y muestra el Trust Score actual.

Featured on ClaudeWave: excalimate/excalimate
[![Featured on ClaudeWave](https://claudewave.com/api/badge/excalimate-excalimate)](https://claudewave.com/repo/excalimate-excalimate)
<a href="https://claudewave.com/repo/excalimate-excalimate"><img src="https://claudewave.com/api/badge/excalimate-excalimate" alt="Featured on ClaudeWave: excalimate/excalimate" width="320" height="64" /></a>

Más MCP Servers