Skip to main content
ClaudeWave
Skill362 repo starsupdated 13d ago

gget-genomic-databases

gget provides unified command-line and Python access to over 20 genomic databases including Ensembl gene lookup, BLAST/BLAT sequence searches, AlphaFold protein structure prediction, Enrichr enrichment analysis, OpenTargets disease associations, CELLxGENE single-cell data, and cancer mutation databases. Use it when you need to query gene information, retrieve sequences, perform sequence alignment, analyze gene set enrichment, explore expression patterns, or investigate disease and drug associations across multiple genomic resources through a consistent interface.

Install in Claude Code
Copy
git clone --depth 1 https://github.com/jaechang-hits/SciAgent-Skills /tmp/gget-genomic-databases && cp -r /tmp/gget-genomic-databases/skills/genomics-bioinformatics/databases/gget-genomic-databases ~/.claude/skills/gget-genomic-databases
Then start a new Claude Code session; the skill loads automatically.

SKILL.md

# gget — Unified Genomic Database Access

## Overview

gget is a command-line and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequences, protein structures, expression data, and disease associations through a consistent interface. All modules work as both CLI tools and Python functions, returning DataFrames (Python) or JSON/CSV (CLI).

## When to Use

- Looking up gene information (names, IDs, descriptions) across species from Ensembl
- Retrieving nucleotide or protein sequences for Ensembl gene/transcript IDs
- Running BLAST or BLAT searches against standard reference databases
- Predicting protein 3D structures with AlphaFold2 from amino acid sequences
- Performing gene set enrichment analysis (GO, KEGG, disease terms) via Enrichr
- Querying single-cell RNA-seq datasets from CELLxGENE Census
- Finding disease and drug associations for a gene target via OpenTargets
- Downloading Ensembl reference genomes and annotations for a species
- Finding cancer mutations and genomic alterations via cBioPortal or COSMIC
- Getting tissue expression and correlated genes from ARCHS4
- For batch processing or advanced BLAST parameters, use `biopython` instead
- For programmatic multi-database workflows with rate limiting, use `bioservices` instead

## Prerequisites

- **Python packages**: `gget`
- **Optional setup**: Some modules require `gget setup <module>` before first use (alphafold, cellxgene, elm, gpt)
- **Environment**: Clean virtual environment recommended to avoid dependency conflicts
- **API notes**: gget queries remote databases — rate-limit large batch queries with `time.sleep()`. Databases update biweekly; keep gget updated. Max ~1000 Ensembl IDs per `gget.info()` call

```bash
pip install gget

# Optional: setup modules that need additional dependencies
gget setup alphafold   # ~4GB model parameters, requires OpenMM
gget setup cellxgene   # cellxgene-census package
gget setup elm         # local ELM database
```

## Quick Start

```python
import gget

# Search for genes by keyword
results = gget.search(["BRCA1", "tumor suppressor"], species="homo_sapiens")
print(f"Found {len(results)} genes")

# Get detailed gene information (Ensembl + UniProt + NCBI)
info = gget.info(["ENSG00000012048"])
print(f"Gene: {info.iloc[0]['primary_gene_name']}")

# Enrichment analysis on a gene list
enrichment = gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology")
print(f"Enriched terms: {len(enrichment)}")
```

## Core API

### Module 1: Reference & Gene Search (ref, search, info, seq)

Query Ensembl for gene references, search by keywords, retrieve gene metadata, and fetch sequences.

```python
import gget

# Search for genes by keyword
results = gget.search(["BRCA1", "tumor suppressor"], species="homo_sapiens")
print(f"Found {len(results)} genes")
print(results[["ensembl_id", "gene_name", "biotype"]].head())

# Get detailed gene information (Ensembl + UniProt + NCBI)
info = gget.info(["ENSG00000012048", "ENSG00000139618"])
print(f"Gene info columns: {list(info.columns)}")
```

```python
import gget

# Retrieve sequences
nucleotide_seqs = gget.seq(["ENSG00000012048"])
protein_seqs = gget.seq(["ENSG00000012048"], translate=True, isoforms=True)
print(f"Retrieved {len(protein_seqs)} isoform sequences")

# Download reference genome files (specify release for reproducibility)
ref_links = gget.ref("homo_sapiens", which="gtf", release=112)
print(f"GTF download link: {ref_links}")
```

### Module 2: Sequence Alignment (blast, blat, muscle, diamond)

BLAST/BLAT remote searches, multiple sequence alignment, and fast local alignment.

```python
import gget
import time

# BLAST against SwissProt (remote API — add delay for batch queries)
blast_results = gget.blast(
    "MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
    database="swissprot", limit=10
)
print(f"Top hit: {blast_results.iloc[0]['Description']}, E-value: {blast_results.iloc[0]['e-value']}")
time.sleep(2)  # Rate-limit between BLAST queries

# BLAT — find genomic position (UCSC)
blat_results = gget.blat("ATCGATCGATCGATCGATCG", assembly="human")
print(f"Genomic location: chr{blat_results.iloc[0]['chromosome']}:{blat_results.iloc[0]['start']}")
```

```python
import gget

# Multiple sequence alignment with Muscle5
aligned = gget.muscle("sequences.fasta", save=True)

# Fast local alignment with DIAMOND (local, no rate limit needed)
diamond_results = gget.diamond(
    "GGETISAWESQME",
    reference="reference.fasta",
    sensitivity="very-sensitive",
    threads=4
)
print(f"Alignments found: {len(diamond_results)}")
```

### Module 3: Protein Structure (pdb, alphafold, elm)

Download PDB structures, predict structures with AlphaFold2, find linear motifs.

```python
import gget

# Download PDB structure
pdb_data = gget.pdb("7S7U", save=True)

# Predict structure with AlphaFold2 (requires gget setup alphafold)
structure = gget.alphafold(
    "MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
    plot=True, show_sidechains=True
)
print("Structure prediction complete, PDB file saved")
```

```python
import gget

# Find Eukaryotic Linear Motifs (requires gget setup elm)
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
print(f"Ortholog motifs: {len(ortholog_df)}, Regex motifs: {len(regex_df)}")
```

### Module 4: Expression & Correlation (archs4, cellxgene, bgee)

Gene expression, tissue expression, correlated genes, single-cell data.

```python
import gget

# Tissue expression from ARCHS4
tissue_expr = gget.archs4("ACE2", which="tissue")
print(f"Expression across {len(tissue_expr)} tissues")

# Correlated genes from ARCHS4
correlated = gget.archs4("ACE2", which="correlation")
print(f"Top correlated gene: {correlated.iloc[0]['gene_symbol']}")
```

```python
import gget

# Single-cell data from CELLxGENE (requires gget setup cellxgene)
adata = gget.cellxgene(
    gene=["ACE2", "TMPRSS2"],
    tissue="lung",
    c
sciagent-skill-creatorSkill

|

opentrons-integrationSkill

Opentrons Protocol API v2 for OT-2/Flex: Python protocols for pipetting, serial dilutions, PCR, plate replication; control thermocycler, heater-shaker, magnetic, temperature modules. Use pylabrobot for multi-vendor.

plotly-interactive-visualizationSkill

Interactive visualization with Plotly. 40+ chart types (scatter, line, heatmap, 3D, geographic) with hover, zoom, pan. Two APIs: Plotly Express (DataFrame) and Graph Objects (fine control). For static publication figures use matplotlib; for statistical grammar use seaborn.

seaborn-statistical-visualizationSkill

Statistical visualization on matplotlib + pandas. Distributions (histplot, kdeplot, violin, box), relational (scatter, line), categorical, regression, correlation heatmaps. Auto aggregation/CIs. Use plotly for interactive; matplotlib for low-level.

single-cell-annotationSkill

Best practices for single-cell RNA-seq cell type annotation including marker-based, reference-based, and automated classification approaches.

pymc-bayesian-modelingSkill

Bayesian modeling with PyMC 5: priors, likelihood, NUTS/ADVI sampling, diagnostics (R-hat, ESS), LOO/WAIC comparison, prediction. Hierarchical, logistic, GP variants; predictive checks.

scikit-survival-analysisSkill

Time-to-event modeling with scikit-survival: Cox PH (elastic net), Random Survival Forests, Boosting, SVMs for censored data. C-index, Brier, time-dependent AUC; Kaplan-Meier, Nelson-Aalen, competing risks. Pipeline/GridSearchCV compatible. Use statsmodels for frequentist, pymc for Bayesian, lifelines for parametric.

statistical-analysisSkill

>-