Skip to main content
ClaudeWave
Skill28.1k repo starsupdated today

gget

gget is a unified command-line and Python interface for querying 20+ bioinformatics databases including gene annotations, sequence analysis tools (BLAST/BLAT), protein structures, expression data, and disease associations. Use it for rapid interactive lookups of genomic information, viral sequences, and enrichment analysis when queries are simple or exploratory rather than requiring batch processing or advanced algorithmic work.

Install in Claude Code
Copy
git clone --depth 1 https://github.com/K-Dense-AI/scientific-agent-skills /tmp/gget && cp -r /tmp/gget/skills/gget ~/.claude/skills/gget
Then start a new Claude Code session; the skill loads automatically.

SKILL.md

# gget

## Overview

gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, viral sequences, expression data, disease associations, and mouse tissue/cell specificity metrics through a consistent interface. Most gget modules work both as command-line tools and as Python functions.

**Important**: The databases queried by gget are continuously updated, which sometimes changes their structure. Guidance here targets gget 0.30.5 (PyPI current as of 2026-06-07). For reproducible work, pin `gget==0.30.5`; for broken upstream database adapters, update gget after checking release notes.

## Installation

Install gget in a clean virtual environment to avoid conflicts:

```bash
# Reproducible install targeting this skill
uv venv .venv
source .venv/bin/activate
uv pip install "gget==0.30.5"

# In Python/Jupyter
import gget
```

## Quick Start

Basic usage pattern for all modules:

```bash
# Command-line
gget <module> [arguments] [options]

# Python
gget.module(arguments, options)
```

Most modules return:
- **Command-line**: JSON (default) or CSV with `-csv` flag
- **Python**: DataFrame or dictionary

Common flags across modules:
- `-o/--out`: Save results to file
- `-q/--quiet`: Suppress progress information
- `-csv`: Return CSV format (command-line only)

Python argument names generally match long CLI options without leading dashes. For example, `--census_version` becomes `census_version=...`. Use `gget <module> --help` for the exact current signature.

## Module Categories

### 1. Reference & Gene Information

#### gget ref - Reference Genome Downloads

Retrieve download links and metadata for Ensembl reference genomes.

**Parameters**:
- `species`: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
- `-w/--which`: Specify return types as comma-separated CLI values or Python list (gtf, cdna, dna, cds, cdrna, pep). Default: all
- `-r/--release`: Ensembl release number (default: latest)
- `-od/--out_dir`: Directory for downloaded files
- `-l/--list_species`: List available vertebrate species
- `-liv/--list_iv_species`: List available invertebrate species
- `-ftp`: Return only FTP links
- `-d/--download`: Download files (requires curl)

**Examples**:
```bash
# List available species
gget ref --list_species

# Get all reference files for human
gget ref homo_sapiens

# Download GTF and cDNA files for mouse
gget ref -w gtf,cdna -d mouse
```

```python
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which=["gtf", "cdna"], download=True)
```

#### gget search - Gene Search

Locate genes by name, description, and Ensembl synonyms across species.

**Parameters**:
- `searchwords`: One or more search terms (case-insensitive)
- `-s/--species`: Target species (e.g., 'homo_sapiens', 'mouse')
- `-r/--release`: Ensembl release number
- `-t/--id_type`: Return 'gene' (default) or 'transcript'
- `-ao/--andor`: 'or' (default) finds ANY searchword; 'and' requires ALL
- `-l/--limit`: Maximum results to return
- `wrap_text`: Python-only display helper for wide DataFrames

**Returns**: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL

**Examples**:
```bash
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric

# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
```

```python
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
```

#### gget info - Gene/Transcript Information

Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.

**Parameters**:
- `ens_ids`: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
- `-n/--ncbi`: Disable NCBI data retrieval
- `-u/--uniprot`: Disable UniProt data retrieval
- `-pdb`: Include PDB identifiers (increases runtime)

**Returns**: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript

**Examples**:
```bash
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296

# Include PDB IDs
gget info ENSG00000034713 -pdb
```

```python
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
```

#### gget seq - Sequence Retrieval

Fetch nucleotide or amino acid sequences for genes and transcripts.

**Parameters**:
- `ens_ids`: One or more Ensembl identifiers
- `-t/--translate`: Fetch amino acid sequences instead of nucleotide
- `-iso/--isoforms`: Return all transcript variants (gene IDs only)

**Returns**: FASTA format sequences

**Examples**:
```bash
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853

# Get all protein isoforms
gget seq -t -iso ENSG00000034713
```

```python
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
```

### 2. Sequence Analysis & Alignment

#### gget blast - BLAST Searches

BLAST nucleotide or amino acid sequences against standard databases.

**Parameters**:
- `sequence`: Sequence string or path to FASTA/.txt file
- `-p/--program`: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
- `-db/--database`:
  - Nucleotide: nt, refseq_rna, pdbnt
  - Protein: nr, swissprot, pdbaa, refseq_protein
- `-l/--limit`: Max hits (default: 50)
- `-e/--expect`: E-value cutoff (default: 10.0)
- `-lcf/--low_comp_filt`: Enable low complexity filtering
- `-mbo/--megablast_off`: Disable MegaBLAST (blastn only)

**Examples**:
```bash
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
```

```python
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
```

#### gget blat - BLAT Searches

Locate genomic positions of sequences using UCSC BLAT.

**Parameters**:
- `sequence`: Sequence string or path to FASTA/.txt fil
adaptyvSkill

How to use the Adaptyv Bio Foundry API and Python SDK for protein experiment design, submission, and results retrieval. Use this skill whenever the user mentions Adaptyv, Foundry API, protein binding assays, protein screening experiments, BLI/SPR assays, thermostability assays, or wants to submit protein sequences for experimental characterization. Also trigger when code imports `adaptyv`, `adaptyv_sdk`, or `FoundryClient`, or references `foundry-api-public.adaptyvbio.com`.

aeonSkill

This skill should be used for time series machine learning tasks including classification, regression, clustering, forecasting, anomaly detection, segmentation, and similarity search. Use when working with temporal data, sequential patterns, or time-indexed observations requiring specialized algorithms beyond standard ML approaches. Particularly suited for univariate and multivariate time series analysis with scikit-learn compatible APIs.

anndataSkill

Data structure for annotated matrices in single-cell analysis. Use when working with .h5ad files or integrating with the scverse ecosystem. This is the data format skill—for analysis workflows use scanpy; for probabilistic models use scvi-tools; for population-scale queries use cellxgene-census.

arboretoSkill

Infer gene regulatory networks (GRNs) from gene expression data using scalable algorithms (GRNBoost2, GENIE3). Use when analyzing transcriptomics data (bulk RNA-seq, single-cell RNA-seq) to identify transcription factor-target gene relationships and regulatory interactions. Supports distributed computation for large-scale datasets.

astropySkill

Core Python library for astronomy and astrophysics workflows that need Astropy APIs, including units/quantities, coordinates, FITS I/O, tables, time systems, WCS, and cosmology. Use when implementing or debugging astronomical data analysis code with Astropy.

autoskillSkill

Observe the user's screen via screenpipe, detect repeated research workflows, match them against existing scientific-agent-skills, and draft new skills (or composition recipes that chain existing ones) for the patterns not yet covered. Use when the user asks to analyze their recent work and propose skills based on what they actually do. Requires the screenpipe daemon (https://github.com/screenpipe/screenpipe) running locally on port 3030 — the skill has no other data source and will refuse to run if screenpipe is unreachable. All detection runs locally; only redacted cluster summaries reach the LLM.

benchling-integrationSkill

Benchling Python SDK and REST API integration for registry entities, inventory, ELN entries, workflows, Benchling Apps, and Data Warehouse queries. Use when automating lab data with benchling-sdk or the v2 API.

bgpt-paper-searchSkill

Search scientific papers and retrieve structured experimental data extracted from full-text studies via the BGPT MCP server. Returns 25+ fields per paper including methods, results, sample sizes, quality scores, and conclusions. Use for literature reviews, evidence synthesis, and finding experimental details not available in abstracts alone.