Skip to main content
ClaudeWave

Create keyframe animations from hand-drawn Excalidraw diagrams — timeline editor, camera animation, sequence reveals, and an MCP server for AI-driven creation with real-time live preview Export as MP4, WebM, GIF, or animated SVG.

MCP Servers46 stars7 forksTypeScriptMITUpdated 5d ago
Install in Claude Code / Claude Desktop
Method: Manual
Claude Code CLI
git clone https://github.com/excalimate/excalimate
claude_desktop_config.json (Claude Desktop)
{
  "mcpServers": {
    "excalimate": {
      "command": "node",
      "args": ["/path/to/excalimate/dist/index.js"]
    }
  }
}
1. Run the command above in your terminal (Claude Code), or paste the JSON config into claude_desktop_config.json (Claude Desktop).
2. Replace any <placeholder> values with your API keys or paths.
3. Restart Claude. The MCP server and its tools appear automatically.
💡 Clone https://github.com/excalimate/excalimate and follow its README for install instructions.
Use cases

MCP Servers overview

README preview not available. Visit the repo on GitHub for full documentation.
aiai-toolsanimationdiagramexcalidrawexcalidraw-animationgifkeyframe-animationmcpmcp-servermodel-context-protocolmotion-designmp4reacttimelinetypescriptvitewhiteboard

What people ask about excalimate

What is excalimate/excalimate?

+

excalimate/excalimate is mcp servers for the Claude AI ecosystem. Create keyframe animations from hand-drawn Excalidraw diagrams — timeline editor, camera animation, sequence reveals, and an MCP server for AI-driven creation with real-time live preview Export as MP4, WebM, GIF, or animated SVG. It has 46 GitHub stars and was last updated 5d ago.

How do I install excalimate?

+

You can install excalimate by cloning the repository (https://github.com/excalimate/excalimate) or following the README instructions on GitHub. ClaudeWave also provides quick install blocks on this page.

Is excalimate/excalimate safe to use?

+

excalimate/excalimate has not been audited yet by our security agent. Review the original repository on GitHub before using it in production.

Who maintains excalimate/excalimate?

+

excalimate/excalimate is maintained by excalimate. The last recorded GitHub activity is from 5d ago, with 12 open issues.

Are there alternatives to excalimate?

+

Yes. On ClaudeWave you can browse similar mcp servers at /categories/mcp, sorted by popularity or recent activity.

Deploy excalimate to your cloud

Ship this repo to production in minutes. Each platform spins up its own environment with editable env vars.

Maintain this repo? Add a badge to your README

Drop the badge into your GitHub README to show it's tracked on ClaudeWave. Each badge links back to this page and reflects the live Trust Score.

Featured on ClaudeWave: excalimate/excalimate
[![Featured on ClaudeWave](https://claudewave.com/api/badge/excalimate-excalimate)](https://claudewave.com/repo/excalimate-excalimate)
<a href="https://claudewave.com/repo/excalimate-excalimate"><img src="https://claudewave.com/api/badge/excalimate-excalimate" alt="Featured on ClaudeWave: excalimate/excalimate" width="320" height="64" /></a>

More MCP Servers