Skip to main content
ClaudeWave

Local‑first MCP server for multi‑repository semantic code search with Qdrant and llama. Turns your entire workspace into private context for AI coding assistants like Claude Code, Codex, Cursor, Copilot, Antigravity and Windsurf.

MCP ServersOfficial Registry10 stars1 forksTypeScriptMITUpdated today
ClaudeWave Trust Score
95/100
Verified
Passed
  • Open-source license (MIT)
  • Actively maintained (<30d)
  • Clear description
  • Topics declared
  • Documented (README)
Last scanned: 9/3/2026
Install in Claude Code / Claude Desktop
Method: Manual
Claude Code CLI
git clone https://github.com/IBazylchuk/paparats-mcp
claude_desktop_config.json (Claude Desktop)
{
  "mcpServers": {
    "paparats-mcp": {
      "command": "node",
      "args": ["/path/to/paparats-mcp/dist/index.js"]
    }
  }
}
1. Run the command above in your terminal (Claude Code), or paste the JSON config into claude_desktop_config.json (Claude Desktop).
2. Replace any <placeholder> values with your API keys or paths.
3. Restart Claude. The MCP server and its tools appear automatically.
💡 Clone https://github.com/IBazylchuk/paparats-mcp and follow its README for install instructions.
Use cases

MCP Servers overview

# Paparats MCP

<img src="docs/paparats-kvetka.png" alt="Paparats-kvetka (fern flower)" width="200" align="right">

[![npm version](https://img.shields.io/npm/v/@paparats/cli?color=01696f)](https://www.npmjs.com/package/@paparats/cli)
[![License: MIT](https://img.shields.io/badge/License-MIT-01696f.svg)](LICENSE)
[![PulseMCP](https://img.shields.io/badge/PulseMCP-listed-01696f)](https://www.pulsemcp.com/servers/paparats-mcp)
[![MCP Badge](https://lobehub.com/badge/mcp/ibazylchuk-paparats-mcp)](https://lobehub.com/mcp/ibazylchuk-paparats-mcp)

[![Open in GitHub Codespaces](https://github.com/codespaces/badge.svg)](https://codespaces.new/IBazylchuk/paparats-mcp) &nbsp;<sub>← try the full stack in your browser, no install ([details](#try-it-in-the-browser-no-install))</sub>

**Paparats-kvetka** — a magical flower from Slavic folklore that blooms on Kupala Night
and grants whoever finds it the power to see hidden things. Likewise, paparats-mcp
helps your agent see the right code across a sea of repositories.

> 🌿 Works with **Claude Code · Cursor · Windsurf · Copilot · Codex · Antigravity** · any MCP-compatible agent

**Give your AI coding assistant deep, real understanding of your entire workspace.**
Paparats indexes every repo you care about — semantically, with AST-aware chunking and
a cross-chunk symbol graph — and exposes it through the Model Context Protocol. Search
by meaning, follow `who-uses-what` through real symbol edges, see who last touched a
chunk and which ticket it came from — all without your code ever leaving your machine.

<a href="docs/dashboard.png"><img src="docs/dashboard.png" alt="Paparats operator console — ROI, top queries, cross-project usage, indexer health, embedding latency (synthetic data)" width="100%"></a>

<sub>📊 The built-in `/ui` operator console — ROI, query quality, cross-project usage, per-user activity, indexer health. <em>Screenshot uses synthetic data (<code>?demo=1</code>) — no real queries, users, or project names.</em></sub>

- ⚡ **One install, one config.** `paparats install` → `paparats add ~/code/repo` → done.
- 🌳 **AST-aware chunking and symbol extraction.** Tree-sitter parses every supported
  file once and feeds both chunking and the cross-chunk symbol graph (calls /
  called_by / references / referenced_by) — 11 languages including TypeScript, Python,
  Go, Rust, Java, Ruby, C, C++, C#.
- 🧠 **Architectural memory that the agent maintains itself.** A second vector store
  per group holds **components, decisions (ADRs) and lessons learned** — your agent
  writes them as it works and reads them before answering. Bootstrap on day one with
  the `init_arch_memory` MCP prompt (the `/init` of architectural memory). Server-side
  similarity gate prevents duplicates, supersedes links replace stale decisions, a
  `min_score` threshold gates low-confidence reads, every card carries an
  "updated N ago" stamp, and Prometheus metrics tell you whether your memory is
  actually being used.
- 💸 **Saves tokens.** Returns only the chunks that matter, with token-savings telemetry
  to prove it (per-query, per-user, per-anchor-project).
- 🔭 **Production-ready observability.** Prometheus `/metrics`, OpenTelemetry traces
  (Tempo, Jaeger, Honeycomb, Datadog, Grafana Cloud, **Elastic APM**), local SQLite
  analytics, and a built-in `/ui` operator console that visualises ROI, query quality,
  cross-project usage and indexer health in one screen.
- 🏠 **100% local by default.** Qdrant + a local embed server (llama.cpp llama-server +
  llama-swap) on your machine. No cloud, no API keys, no telemetry leaving the box. Bring
  your own Qdrant Cloud / embed server URL if you want.

---

## Table of Contents

- [Why Paparats?](#why-paparats)
- [Quick Start](#quick-start)
- [How the install works](#how-the-install-works)
- [Install variants](#install-variants)
- [Migrating from a v1 install](#migrating-from-a-v1-install)
- [Support agent setup](#support-agent-setup)
- [How It Works](#how-it-works)
- [Key Features](#key-features)
- [Use Cases](#use-cases)
- [Architectural memory](#architectural-memory-agent-maintained-adrs-components-lessons)
- [Configuration](#configuration)
- [MCP Tools Reference](#mcp-tools-reference)
- [Connecting MCP](#connecting-mcp)
- [CLI Commands](#cli-commands)
- [Monitoring](#monitoring)
- [Analytics & Observability](#analytics--observability)
- [Architecture](#architecture)
- [Embedding Model Setup](#embedding-model-setup)
- [Comparison with Alternatives](#comparison-with-alternatives)
- [Token Savings Metrics](#token-savings-metrics)
- [Contributing](#contributing)
- [Links](#links)

---

## Why Paparats?

AI coding assistants are smart, but they can only see files you open. They don't know your codebase structure, where the authentication logic lives, or how services connect. **Paparats fixes that.**

### What you get

- **Semantic code search** — ask "where is the rate limiting logic?" and get exact code ranked by meaning, not grep matches
- **Real-time sync** — edit a file, and 2 seconds later it's re-indexed. No manual re-runs
- **Cross-chunk symbol graph** — `find_usages` walks AST-derived edges (calls, called_by, references, referenced_by) so the agent can trace dependencies without re-grepping
- **Token savings** — return only relevant chunks instead of full files to reduce context size
- **Multi-project workspaces** — search across backend, frontend, infra repos in one query
- **100% local & private** — Qdrant vector database + local llama-server embeddings. Nothing leaves your laptop
- **AST-aware chunking** — code split by AST nodes (functions/classes) via tree-sitter, not arbitrary character counts (TypeScript, JavaScript, TSX, Python, Go, Rust, Java, Ruby, C, C++, C#; regex fallback for Terraform)
- **Rich metadata** — each chunk knows its symbol name (from tree-sitter AST), service, domain context, and tags from directory structure
- **Git history per chunk** — see who last modified a chunk, when, and which tickets (Jira, GitHub) are linked to it
- **Architectural memory** — a living knowledge base of components, decisions (ADRs) and lessons learned, written by the agent as it learns, deduplicated server-side by vector similarity, and consulted on every support query so the agent stays consistent across sessions

### Who benefits

| Use Case                    | How Paparats Helps                                                                                     |
| --------------------------- | ------------------------------------------------------------------------------------------------------ |
| **Solo developers**         | Quickly navigate unfamiliar codebases, find examples of patterns, reduce context-switching             |
| **Multi-repo teams**        | Cross-project search (backend + frontend + infra), consistent patterns, faster onboarding              |
| **AI agents**               | Foundation for product support bots, QA automation, dev assistants — any agent that needs code context |
| **Legacy modernization**    | Find all usages of deprecated APIs, identify migration patterns, discover hidden dependencies          |
| **Contractors/consultants** | Accelerate ramp-up on client codebases, reduce "where is X?" questions                                 |

---

## Quick Start

### Try it in the browser (no install)

[![Open in GitHub Codespaces](https://github.com/codespaces/badge.svg)](https://codespaces.new/IBazylchuk/paparats-mcp)

Spin up a full Qdrant + embed server + paparats stack in a Codespace.
A small slice of the repo (`packages/shared/src`) is auto-indexed on first start so
you can run

```bash
paparats search -g demo 'gitignore filter'
```

within a few minutes. Codespace forwards port 9876 for MCP — point Cursor/Claude Code
at it via the URL VS Code shows in the Ports panel.

> Note: Codespaces is for demo only. With CPU embedding the full repo
> would take 15+ minutes and can hit batch timeouts on large files. For real
> workloads run locally — or set `OPENAI_API_KEY` (or `VOYAGE_API_KEY`) as a
> Codespaces user secret and indexing drops to a couple of seconds; see the
> Embedding providers section below.

### Run locally

You need **Docker** and **Docker Compose v2**. On macOS, also install the **embed server
natively** — running it inside Docker on macOS is significantly slower because the Docker
VM cannot use Apple Silicon GPU (Metal) acceleration.

```bash
# 1. Install the CLI.
npm install -g @paparats/cli

# 2. macOS only — install the native embed server (Linux uses the Docker embed
#    image by default). Metal-accelerated.
brew install llama.cpp mostlygeek/llama-swap/llama-swap

# 3. One-time bootstrap. Generates ~/.paparats/{docker-compose.yml,projects.yml},
#    starts the stack, downloads the embedding model, wires Cursor/Claude Code MCP.
paparats install

# 4. Add the projects you want indexed. Local paths bind-mount read-only into the
#    indexer; git URLs and owner/repo shorthand get cloned.
paparats add ~/code/my-project
paparats add git@github.com:acme/billing.git
paparats add acme/widgets

# 5. Watch it work.
paparats list
```

That's it. Your IDE is already wired (`~/.cursor/mcp.json`, `~/.claude/mcp.json`) to
`http://localhost:9876/mcp`. Open Cursor or Claude Code and ask:

> "Search this workspace for the auth middleware and show me everything that calls it."

### Existing v1 user?

Just run `paparats install` again. The installer detects the legacy per-project
compose, asks once before swapping it for the new global setup, and **preserves your
indexed data** (Qdrant collections, SQLite metadata, embedding cache). Your in-repo
`.paparats.yml` files keep working as per-project overrides.

---

## How the install works

`paparats install` is the only setup command. It creates a single global home at
`~/.paparats/`, brings up a Docker stack, and wires your MCP clients. Re-run it any time
to reconfigure — it diffs the existing compose and asks before overwriting hand edits.

```
~/.paparats/
├── doc
aiai-codinganthropicclaude-codecode-searchcodexcursorembeddingllama-cpplocal-firstmcpmcp-servermodel-context-protocolmulti-repoopenaiprivacyqdrantragsemantic-code-searchvector-database

What people ask about paparats-mcp

What is IBazylchuk/paparats-mcp?

+

IBazylchuk/paparats-mcp is mcp servers for the Claude AI ecosystem. Local‑first MCP server for multi‑repository semantic code search with Qdrant and llama. Turns your entire workspace into private context for AI coding assistants like Claude Code, Codex, Cursor, Copilot, Antigravity and Windsurf. It has 10 GitHub stars and its last recorded update is dated 2026-09-02.

How do I install paparats-mcp?

+

You can install paparats-mcp by cloning the repository (https://github.com/IBazylchuk/paparats-mcp) or following the README instructions on GitHub. ClaudeWave also provides quick install blocks on this page.

Is IBazylchuk/paparats-mcp safe to use?

+

Our security agent has analyzed IBazylchuk/paparats-mcp and assigned a Trust Score of 95/100 (tier: Verified). See the full breakdown of passed checks and flags on this page.

Who maintains IBazylchuk/paparats-mcp?

+

IBazylchuk/paparats-mcp is maintained by IBazylchuk. The last recorded GitHub activity is dated 2026-09-02, with 1 open issues.

Are there alternatives to paparats-mcp?

+

Yes. On ClaudeWave you can browse similar mcp servers at /categories/mcp, sorted by popularity or recent activity.

Deploy paparats-mcp to your cloud

Ship this repo to production in minutes. Each platform spins up its own environment with editable env vars.

Maintain this repo? Add a badge to your README

Drop the badge into your GitHub README to show it's tracked on ClaudeWave. Each badge links back to this page and reflects the live Trust Score.

Featured on ClaudeWave: IBazylchuk/paparats-mcp
[![Featured on ClaudeWave](https://claudewave.com/api/badge/ibazylchuk-paparats-mcp)](https://claudewave.com/repo/ibazylchuk-paparats-mcp)
<a href="https://claudewave.com/repo/ibazylchuk-paparats-mcp"><img src="https://claudewave.com/api/badge/ibazylchuk-paparats-mcp" alt="Featured on ClaudeWave: IBazylchuk/paparats-mcp" width="320" height="64" /></a>

More MCP Servers

paparats-mcp alternatives