Skip to main content
ClaudeWave

MisarMail MCP server — 54 tools for email, campaigns, contacts, automations, A/B testing, and deliverability. Works with Claude, Cursor, VS Code, Windsurf, ChatGPT & any MCP client.

MCP ServersOfficial Registry0 stars0 forksTypeScriptMITUpdated today
ClaudeWave Trust Score
95/100
Verified
Passed
  • Open-source license (MIT)
  • Actively maintained (<30d)
  • Clear description
  • Topics declared
  • Documented (README)
Last scanned: 8/19/2026
Install in Claude Code / Claude Desktop
Method: NPX · @smithery/cli
Claude Code CLI
claude mcp add misarmail-mcp -- npx -y @smithery/cli
claude_desktop_config.json (Claude Desktop)
{
  "mcpServers": {
    "misarmail-mcp": {
      "command": "npx",
      "args": ["-y", "@smithery/cli"]
    }
  }
}
1. Run the command above in your terminal (Claude Code), or paste the JSON config into claude_desktop_config.json (Claude Desktop).
2. Replace any <placeholder> values with your API keys or paths.
3. Restart Claude. The MCP server and its tools appear automatically.
Use cases

MCP Servers overview

# MisarMail MCP Server

> Send email, run campaigns, manage contacts and automations, A/B test, and audit deliverability — from any AI assistant.

[![npm](https://img.shields.io/npm/v/@misarmail/mcp)](https://www.npmjs.com/package/@misarmail/mcp)
[![smithery](https://img.shields.io/badge/smithery-misar%2Fmisarmail--mcp-blue)](https://smithery.ai/servers/misar/misarmail-mcp)
[![license](https://img.shields.io/badge/license-MIT-green)](./LICENSE)

**54 tools · 8 prompts · 4 resources · 8 agent skills**

Works with Claude (Desktop, Code, and web), Cursor, VS Code, Windsurf, Cline,
Zed, Gemini CLI, ChatGPT, and any other MCP-compatible client — over stdio or
Streamable HTTP.

---

## Install

### Smithery (recommended)

```bash
npx -y @smithery/cli install misar/misarmail-mcp --client claude
```

### Claude Code

```bash
claude mcp add misarmail -- npx -y @misarmail/mcp@latest
```

### Manual (any client)

```json
{
  "mcpServers": {
    "misarmail": {
      "command": "npx",
      "args": ["-y", "@misarmail/mcp@latest"],
      "env": { "MISARMAIL_API_KEY": "msk_your_key_here" }
    }
  }
}
```

Ready-made configs for every client live in [`connectors/`](./connectors).

### Remote (no install)

```json
{
  "mcpServers": {
    "misarmail": {
      "type": "streamable-http",
      "url": "https://api.misar.io/mail/mcp",
      "headers": { "Authorization": "Bearer msk_your_key_here" }
    }
  }
}
```

---

## Authentication

Two options — no copy-paste needed for the first:

1. **Browser login.** Start the server with no key and run the `login` tool.
   It opens the MisarMail consent screen, you review the requested
   permissions, and the key is delivered straight back and saved to
   `~/.misarmail/config.json`.
2. **API key.** Create one at https://mail.misar.io/developers and set `MISARMAIL_API_KEY`.

Self-hosted instances: set `MISARMAIL_BASE_URL`.

---

## Tools

| Tool | Description |
| --- | --- |
| `send_email` | Send a transactional email from a verified MisarMail account. |
| `list_emails` | List emails from a mailbox folder with optional full-text search across subject and body. |
| `get_email` | Read the full content of a single email by ID, including headers, body, and attachments metadata. |
| `reply_to_email` | Reply to an existing email thread. |
| `archive_email` | Move an email to the archive folder. |
| `validate_email` | Validate an email address before sending: syntax, MX records, disposable-domain and role-account detection. |
| `list_campaigns` | List email marketing campaigns with their status, audience size, and headline metrics. |
| `get_campaign` | Get full details for one campaign: content, audience segment, schedule, and delivery statistics (sent, opened, clicked, bounced, complained).. |
| `create_campaign` | Create a new email marketing campaign as a draft. |
| `send_campaign` | Send a campaign now, or schedule it for a future time by passing scheduled_at. |
| `list_contacts` | List contacts with their subscription status and engagement metrics. |
| `create_contact` | Add a single contact. |
| `update_contact` | Update an existing contact by email address, including changing subscription status. |
| `import_contacts` | Bulk-import up to 5,000 contacts in one call. |
| `get_contact_score` | Get engagement score, engagement tier, and churn risk for one contact — or the lowest-engagement contacts across the list when contact_id is omitted. |
| `list_templates` | List saved email templates with their variable placeholders, so you can pick one for a campaign or transactional send.. |
| `create_template` | Create a reusable email template. |
| `render_template` | Render a template with sample variables and return the resulting HTML and subject. |
| `list_automations` | List automation workflows (welcome series, re-engagement, drip sequences) with their trigger type and active state.. |
| `get_automation` | Get one automation workflow in full: trigger, every step with its delay, and per-step completion stats.. |
| `create_automation` | Create an automation workflow from a trigger and an ordered list of steps. |
| `toggle_automation` | Activate or pause an automation. |
| `list_ab_tests` | List A/B tests with per-variant results and whether a winner has been selected yet.. |
| `create_ab_test` | Create an A/B test on a campaign with two or more variants. |
| `select_ab_test_winner` | Select the winning variant and send it to the remaining audience. |
| `get_analytics` | Get delivery and engagement analytics — sent, delivered, opened, clicked, bounced, and complained — for the account or one campaign, grouped by day/week/month.. |
| `generate_report` | Generate a structured analytics report over a date range. |
| `get_revenue_attribution` | Attribute ecommerce revenue to email — revenue per campaign, per contact, and average order value from tracked conversions.. |
| `get_monetization_stats` | Get newsletter monetization stats: paid subscribers, MRR, churn, and sponsorship revenue for the period.. |
| `get_deliverability_score` | Get the account deliverability score (0–100) and letter grade (A–F) with the factors dragging it down. |
| `run_deliverability_audit` | Run a full deliverability audit across authentication (SPF/DKIM/DMARC), domain reputation, list hygiene, content signals, and blocklist status. |
| `get_warmup_status` | Get IP/domain warm-up progress and today's remaining send capacity. |
| `check_dmarc` | Check live SPF, DKIM, and DMARC DNS records for a domain and report alignment problems with the exact record to publish. |
| `list_domains` | List sending domains with verification status and their DKIM/SPF/DMARC records. |
| `add_domain` | Add a sending domain and return the DNS records to publish. |
| `verify_domain` | Re-check a domain's DNS records and mark it verified if they resolve. |
| `configure_inbound_domain` | Configure inbound email routing for a subdomain so replies land in the MisarMail unified inbox. |
| `list_forms` | List signup forms with their embed status and conversion counts.. |
| `get_form` | Get one signup form including its fields, embed code, and redirect behaviour.. |
| `get_form_submissions` | List submissions for a signup form, including the submitted field values and timestamps.. |
| `create_landing_page` | Create a hosted landing page with an email capture form. |
| `list_marketplace_items` | Browse the MisarMail template marketplace for ready-made email and automation templates.. |
| `get_marketplace_item` | Get one marketplace listing with its full preview, author, and install count.. |
| `list_inbox_conversations` | List unified-inbox conversations (threads) with their status and detected intent. |
| `get_inbox_conversation_messages` | Get every message in one inbox conversation, oldest first, with sender and timestamps.. |
| `categorize_inbox_emails` | Run AI categorisation over a batch of inbox emails to label intent and priority. |
| `list_api_keys` | List API keys on the account with their scopes and last-used time. |
| `generate_subject_lines` | Generate AI subject-line variants for a campaign topic, optionally tuned to a tone and audience. |
| `list_integrations` | List connected third-party integrations and their sync status.. |
| `get_integration` | Get one integration's configuration, scopes, and last sync result.. |
| `toggle_integration` | Enable or disable an integration. |
| `list_sandbox_sends` | List emails captured by sandbox mode. |
| `clear_sandbox` | Delete every captured sandbox email. |
| `upgrade` | Show the current MisarMail plan, how much of each quota is left, and what upgrading unlocks. |

## Prompts

Reusable workflows your client exposes as slash-commands.

| Prompt | Description |
| --- | --- |
| `compose_email` | Draft a professional email and send it via MisarMail after confirmation. |
| `campaign_performance_report` | Analyse campaign performance and produce prioritized improvements. |
| `contact_import_guide` | Import and organise contacts safely, with consent and hygiene checks. |
| `automation_builder_guide` | Design and build an email automation workflow step by step. |
| `deliverability_improvement_plan` | Diagnose deliverability and produce a prioritized weekly action plan. |
| `ab_test_plan` | Design a statistically meaningful A/B test for a campaign. |
| `list_hygiene_audit` | Find and clean the contacts that are hurting sender reputation. |
| `weekly_email_report` | Produce a stakeholder-ready weekly email performance summary. |

## Resources

Read-only context an agent can attach without spending a tool call.

| URI | Description |
| --- | --- |
| `misarmail://account/domains` | Your sending domains with verification state and DNS records. |
| `misarmail://account/deliverability` | Current account deliverability score (0–100), grade, and contributing factors.. |
| `misarmail://account/warmup` | IP/domain warm-up stage and remaining send capacity for today — the ceiling a bulk send must stay under.. |
| `misarmail://templates` | Saved templates with their declared variables, for reuse in campaigns and sends.. |

## Agent skills

Bundled in [`skills/`](./skills) — guidance an agent loads when a task matches.

| Skill | Use when |
| --- | --- |
| `ab-test-campaign` | Design and run an A/B test on a MisarMail campaign — subject line, content, sender name, or send time. Use for "A/B test", "split test", "which subject works better", or testing email variants. |
| `audit-deliverability` | Diagnose why MisarMail emails land in spam or bounce, and produce a prioritized fix list. Use for "emails going to spam", "not being delivered", "low open rate", "domain reputation", DMARC/SPF/DKIM, or blocklist questions. |
| `build-email-automation` | Design and build a MisarMail automation workflow — welcome series, drip sequence, re-engagement, or onboarding. Use for "automate", "drip", "welcome series", "sequence", or trigger-based email. |
| `clean-contact-list` | Audit and clean a MisarMail contact list — bounced, complai
aiai-agentautomationcampaignsclaudecontactscursordeliverabilityemailemail-marketingmcpmcp-servermisarmailmodel-context-protocoltransactional-emailtypescript

What people ask about misarmail-mcp

What is Misar-AI/misarmail-mcp?

+

Misar-AI/misarmail-mcp is mcp servers for the Claude AI ecosystem. MisarMail MCP server — 54 tools for email, campaigns, contacts, automations, A/B testing, and deliverability. Works with Claude, Cursor, VS Code, Windsurf, ChatGPT & any MCP client. It has 0 GitHub stars and its last recorded update is dated 2026-08-19.

How do I install misarmail-mcp?

+

You can install misarmail-mcp by cloning the repository (https://github.com/Misar-AI/misarmail-mcp) or following the README instructions on GitHub. ClaudeWave also provides quick install blocks on this page.

Is Misar-AI/misarmail-mcp safe to use?

+

Our security agent has analyzed Misar-AI/misarmail-mcp and assigned a Trust Score of 95/100 (tier: Verified). See the full breakdown of passed checks and flags on this page.

Who maintains Misar-AI/misarmail-mcp?

+

Misar-AI/misarmail-mcp is maintained by Misar-AI. The last recorded GitHub activity is dated 2026-08-19, with 0 open issues.

Are there alternatives to misarmail-mcp?

+

Yes. On ClaudeWave you can browse similar mcp servers at /categories/mcp, sorted by popularity or recent activity.

Deploy misarmail-mcp to your cloud

Ship this repo to production in minutes. Each platform spins up its own environment with editable env vars.

Maintain this repo? Add a badge to your README

Drop the badge into your GitHub README to show it's tracked on ClaudeWave. Each badge links back to this page and reflects the live Trust Score.

Featured on ClaudeWave: Misar-AI/misarmail-mcp
[![Featured on ClaudeWave](https://claudewave.com/api/badge/misar-ai-misarmail-mcp)](https://claudewave.com/repo/misar-ai-misarmail-mcp)
<a href="https://claudewave.com/repo/misar-ai-misarmail-mcp"><img src="https://claudewave.com/api/badge/misar-ai-misarmail-mcp" alt="Featured on ClaudeWave: Misar-AI/misarmail-mcp" width="320" height="64" /></a>

More MCP Servers

misarmail-mcp alternatives