Skip to main content
ClaudeWave

Browse Hacker News feeds, threads, and user profiles with full-text search via MCP. STDIO or Streamable HTTP.

MCP ServersOfficial Registry4 stars1 forksTypeScriptApache-2.0Updated today
ClaudeWave Trust Score
95/100
Verified
Passed
  • Open-source license (Apache-2.0)
  • Actively maintained (<30d)
  • Clear description
  • Topics declared
  • Documented (README)
Last scanned: 9/14/2026
Install in Claude Code / Claude Desktop
Method: Manual
Claude Code CLI
git clone https://github.com/cyanheads/hn-mcp-server
claude_desktop_config.json (Claude Desktop)
{
  "mcpServers": {
    "hn": {
      "command": "node",
      "args": ["/path/to/hn-mcp-server/dist/index.js"]
    }
  }
}
1. Run the command above in your terminal (Claude Code), or paste the JSON config into claude_desktop_config.json (Claude Desktop).
2. Replace any <placeholder> values with your API keys or paths.
3. Restart Claude. The MCP server and its tools appear automatically.
💡 Clone https://github.com/cyanheads/hn-mcp-server and follow its README for install instructions.
Use cases

MCP Servers overview

<div align="center">
  <h1>@cyanheads/hn-mcp-server</h1>
  <p><b>Browse Hacker News feeds, threads, and user profiles with full-text search via MCP. STDIO or Streamable HTTP.</b>
  <div>4 Tools</div>
  </p>
</div>

<div align="center">

[![Version](https://img.shields.io/badge/Version-0.5.16-blue.svg?style=flat-square)](./CHANGELOG.md) [![License](https://img.shields.io/badge/License-Apache%202.0-orange.svg?style=flat-square)](./LICENSE) [![Docker](https://img.shields.io/badge/Docker-ghcr.io-2496ED?style=flat-square&logo=docker&logoColor=white)](https://github.com/users/cyanheads/packages/container/package/hn-mcp-server) [![MCP SDK](https://img.shields.io/badge/MCP%20SDK-2.0.0-green.svg?style=flat-square)](https://modelcontextprotocol.io/) [![npm](https://img.shields.io/npm/v/@cyanheads/hn-mcp-server?style=flat-square&logo=npm&logoColor=white)](https://www.npmjs.com/package/@cyanheads/hn-mcp-server) [![TypeScript](https://img.shields.io/badge/TypeScript-^7.0.2-3178C6.svg?style=flat-square)](https://www.typescriptlang.org/) [![Bun](https://img.shields.io/badge/Bun->=1.4.0-f9f1e1.svg?style=flat-square)](https://bun.sh/)

</div>

<div align="center">

[![Install in Claude Desktop](https://img.shields.io/badge/Install_in-Claude_Desktop-D97757?style=for-the-badge&logo=anthropic&logoColor=white)](https://github.com/cyanheads/hn-mcp-server/releases/latest/download/hn-mcp-server.mcpb) [![Install in Cursor](https://cursor.com/deeplink/mcp-install-dark.svg)](https://cursor.com/en/install-mcp?name=hn-mcp-server&config=eyJjb21tYW5kIjoibnB4IiwiYXJncyI6WyIteSIsIkBjeWFuaGVhZHMvaG4tbWNwLXNlcnZlciJdfQ==) [![Install in VS Code](https://img.shields.io/badge/VS_Code-Install_Server-0098FF?style=for-the-badge&logo=visualstudiocode&logoColor=white)](https://vscode.dev/redirect?url=vscode:mcp/install?%7B%22name%22%3A%22hn-mcp-server%22%2C%22command%22%3A%22npx%22%2C%22args%22%3A%5B%22-y%22%2C%22%40cyanheads/hn-mcp-server%22%5D%7D)

[![Framework](https://img.shields.io/badge/Built%20on-@cyanheads/mcp--ts--core-67E8F9?style=flat-square)](https://www.npmjs.com/package/@cyanheads/mcp-ts-core)

</div>

<div align="center">

**Public Hosted Server:** [https://hn.caseyjhand.com/mcp](https://hn.caseyjhand.com/mcp)

</div>

---

## Overview

Feeds, threads, and profiles from the Hacker News Firebase API and Algolia Search API. Browse ranked feeds, read full comment threads, look up user profiles, and search stories and comments by type, author, date, or score. Runs as a stdio process, a local Streamable HTTP server, or the public hosted endpoint above.

### Tools

| Tool | Description |
|:---|:---|
| `hn_get_stories` | Fetch stories from an HN feed (top, new, best, ask, show, jobs), with title, URL, score, author, and comment count |
| `hn_get_thread` | Get an item and its comment tree as a threaded discussion, with depth and comment-count controls |
| `hn_get_user` | Fetch a user profile with karma, about, and optionally a page of resolved submissions |
| `hn_search_content` | Search stories and comments via Algolia, filterable by type, author, date range, and minimum points |

## Capability reference

### `hn_get_stories` <sub>tool</sub>

- Six feed types: `top`, `new`, `best`, `ask`, `show`, `jobs`; `count` (1–100, default 30) and `offset` for pagination
- Returns id, type, title, url, domain, score, author, timestamp, comment count, and body text — each field omitted (not null) when HN doesn't provide it
- Enrichment reports `total`, `offset`, `hasMore`, and a `notice` explaining empty pages (empty feed, offset past end, or every item on the page deleted/flagged)

---

### `hn_get_thread` <sub>tool</sub>

- `itemId` plus `depth` (0–10, default 3; 0 returns the item with no comments) and `maxComments` (1–200, default 50) capping the total across all levels
- Breadth-first traversal ranked like HN — top-ranked top-level comments resolve first, replies fill in only after the level above is exhausted
- Flat comment list carries `depth`/`parentId` for tree reconstruction, plus `childCount` and an `isOp` flag when the comment author matches the root item's author
- `notice` reports deleted/dead comments omitted during traversal and, when `totalLoaded` is below `totalAvailable`, the hint to raise `maxComments`/`depth`

---

### `hn_get_user` <sub>tool</sub>

- `username` is case-sensitive and trimmed; `includeSubmissions` (default false) resolves recent submissions, with `submissionCount` (1–50, default 10) and `submissionOffset` paging through a long history
- Profile includes karma, creation date, and about text (HTML stripped); submissions filter out dead/deleted items
- Enrichment echoes `submissionOffset` and the offset to send next, or a notice when the requested offset is past the end of the history

---

### `hn_search_content` <sub>tool</sub>

- Free-text `query` plus `tags` (`story`/`comment`/`ask_hn`/`show_hn`/`front_page`), `author`, `dateRange` (ISO 8601), and `minPoints` filters; `sort` by relevance or date; `count` (1–50, default 30) and `page` for pagination
- `view: "compact"` drops the two body-text fields (`text`, `highlights.text`), which otherwise repeat a long comment twice per hit — pass a hit id to `hn_get_thread` to read the body
- Highlight metadata (`highlights.title`, `highlights.text`, `matchedWords`) shows which terms matched and where
- Enrichment reports `totalHits`, `page`, and the actual reachable `totalPages` — not derived from `totalHits`, since broad queries report far more hits than Algolia will serve

## Features

Built on [`@cyanheads/mcp-ts-core`](https://github.com/cyanheads/mcp-ts-core): stdio and Streamable HTTP transports, pluggable auth (`none` / `jwt` / `oauth`), swappable storage (`in-memory`, `filesystem`, `Supabase`, `Cloudflare KV/R2/D1`), structured logging with optional OpenTelemetry tracing.

HN-specific:

- Two upstream APIs: HN's Firebase API for feeds, items, and users; Algolia's HN Search API for full-text search
- Concurrent batch fetching with configurable parallelism for item resolution (`HN_CONCURRENCY_LIMIT`)
- HTML entity decoding and tag stripping, preserving code blocks and links
- Server-level `instructions` forwarded to LLM clients on `initialize` — item types, ID reuse across tools, case-sensitive usernames, field sparsity
- No API keys required — both upstream APIs are public

Agent-friendly output:

- Graceful partial failure — `hn_get_thread` counts deleted and dead comments dropped during traversal and surfaces the count in `notice` rather than silently shrinking the result; `hn_get_stories` and `hn_get_user` filter dead/deleted items the same way
- Discriminated output contracts — typed error reasons (`item_not_found`, `upstream_rate_limited`, `upstream_html`, …) with per-reason recovery text, and a `depth`/`parentId` pair on every comment so callers reconstruct the tree without guessing nesting
- Pagination provenance — every paged tool echoes the offset it used (`offset`, `submissionOffset`, `page`) plus the exact next-offset value in `notice`, so an agent can resume a listing without recomputing state
- Response shaping — HTML stripping, URL normalization, and domain extraction remove upstream markup noise; `hn_search_content`'s `view: "compact"` drops the two body-text fields that otherwise duplicate a hit's full text

## Getting started

### Public Hosted Instance

A public instance is available at `https://hn.caseyjhand.com/mcp` — no installation required. Point any MCP client at it via Streamable HTTP:

```json
{
  "mcpServers": {
    "hn-mcp-server": {
      "type": "streamable-http",
      "url": "https://hn.caseyjhand.com/mcp"
    }
  }
}
```

### Self-Hosted / Local

Add to your MCP client configuration file:

```json
{
  "mcpServers": {
    "hn-mcp-server": {
      "type": "stdio",
      "command": "bunx",
      "args": ["@cyanheads/hn-mcp-server@latest"],
      "env": {
        "MCP_TRANSPORT_TYPE": "stdio",
        "MCP_LOG_LEVEL": "info"
      }
    }
  }
}
```

Or with npx (no Bun required):

```json
{
  "mcpServers": {
    "hn-mcp-server": {
      "type": "stdio",
      "command": "npx",
      "args": ["-y", "@cyanheads/hn-mcp-server"],
      "env": {
        "MCP_TRANSPORT_TYPE": "stdio",
        "MCP_LOG_LEVEL": "info"
      }
    }
  }
}
```

Or with Docker:

```json
{
  "mcpServers": {
    "hn-mcp-server": {
      "type": "stdio",
      "command": "docker",
      "args": [
        "run", "-i", "--rm",
        "-e", "MCP_TRANSPORT_TYPE=stdio",
        "ghcr.io/cyanheads/hn-mcp-server:latest"
      ]
    }
  }
}
```

### Prerequisites

- [Bun v1.4.0](https://bun.sh/) or higher (or Node.js >= 24)

### Installation

```sh
git clone https://github.com/cyanheads/hn-mcp-server.git
cd hn-mcp-server
bun install
```

## Configuration

All configuration is via environment variables. No API keys required — HN APIs are public.

| Variable | Description | Default |
|:---------|:------------|:--------|
| `HN_CONCURRENCY_LIMIT` | Max concurrent HTTP requests for batch item fetches (integer, 1–50). | `10` |
| `MCP_TRANSPORT_TYPE` | Transport: `stdio` or `http`. | `stdio` |
| `MCP_HTTP_PORT` | HTTP server port. | `3010` |
| `MCP_HTTP_HOST` | HTTP server host. | `localhost` |
| `MCP_SESSION_MODE` | HTTP session handling: `auto`, `stateful`, or `stateless`. `auto` resolves to `stateful`. The published Docker image and `.env.example` pin `stateless`. | `auto` |
| `MCP_LOG_LEVEL` | Log level: `debug`, `info`, `notice`, `warning`, `error`. | `info` |
| `LOGS_DIR` | Directory for log files (Node.js only). | `<project-root>/logs` |

See [`.env.example`](./.env.example) for the full list of optional overrides.

## Running the server

### Local development

- **Dev mode (auto-reload):**

  ```sh
  MCP_TRANSPORT_TYPE=stdio bun --watch src/index.ts   # stdio
  MCP_TRANSPORT_TYPE=http bun --watch src/index.ts    # HTTP
  ```

- **Build and run:**

  ```sh
  bun run rebuild
  bun run start:stdio   # or start:http
  ```

- **Run checks and tests:**

  ```sh
  bun run devcheck   # Li
cyanheadshacker-newshackernewshnmcpmcp-servermodel-context-protocoltypescript

What people ask about hn-mcp-server

What is cyanheads/hn-mcp-server?

+

cyanheads/hn-mcp-server is mcp servers for the Claude AI ecosystem. Browse Hacker News feeds, threads, and user profiles with full-text search via MCP. STDIO or Streamable HTTP. It has 4 GitHub stars and its last recorded update is dated 2026-09-13.

How do I install hn-mcp-server?

+

You can install hn-mcp-server by cloning the repository (https://github.com/cyanheads/hn-mcp-server) or following the README instructions on GitHub. ClaudeWave also provides quick install blocks on this page.

Is cyanheads/hn-mcp-server safe to use?

+

Our security agent has analyzed cyanheads/hn-mcp-server and assigned a Trust Score of 95/100 (tier: Verified). See the full breakdown of passed checks and flags on this page.

Who maintains cyanheads/hn-mcp-server?

+

cyanheads/hn-mcp-server is maintained by cyanheads. The last recorded GitHub activity is dated 2026-09-13, with 9 open issues.

Are there alternatives to hn-mcp-server?

+

Yes. On ClaudeWave you can browse similar mcp servers at /categories/mcp, sorted by popularity or recent activity.

Deploy hn-mcp-server to your cloud

Ship this repo to production in minutes. Each platform spins up its own environment with editable env vars.

Maintain this repo? Add a badge to your README

Drop the badge into your GitHub README to show it's tracked on ClaudeWave. Each badge links back to this page and reflects the live Trust Score.

Featured on ClaudeWave: cyanheads/hn-mcp-server
[![Featured on ClaudeWave](https://claudewave.com/api/badge/cyanheads-hn-mcp-server)](https://claudewave.com/repo/cyanheads-hn-mcp-server)
<a href="https://claudewave.com/repo/cyanheads-hn-mcp-server"><img src="https://claudewave.com/api/badge/cyanheads-hn-mcp-server" alt="Featured on ClaudeWave: cyanheads/hn-mcp-server" width="320" height="64" /></a>

More MCP Servers

hn-mcp-server alternatives