Skip to main content
ClaudeWave

MCP connector for Hungarian legislation (Nemzeti Jogszabalytar) via structured retrieval

MCP ServersOfficial Registry0 stars0 forksPythonApache-2.0Updated today
ClaudeWave Trust Score
95/100
Verified
Passed
  • Open-source license (Apache-2.0)
  • Actively maintained (<30d)
  • Clear description
  • Topics declared
  • Documented (README)
Last scanned: 8/25/2026
Install in Claude Code / Claude Desktop
Method: pip / Python · -e
Claude Code CLI
claude mcp add hu-eli-mcp -- python -m -e
claude_desktop_config.json (Claude Desktop)
{
  "mcpServers": {
    "hu-eli-mcp": {
      "command": "python",
      "args": ["-m", "pip"]
    }
  }
}
1. Run the command above in your terminal (Claude Code), or paste the JSON config into claude_desktop_config.json (Claude Desktop).
2. Replace any <placeholder> values with your API keys or paths.
3. Restart Claude. The MCP server and its tools appear automatically.
💡 Install first: pip install -e
Use cases

MCP Servers overview

# hu-eli-mcp

<!-- mcp-name: io.github.matematicsolutions/hu-eli-mcp -->

An MCP server for **Hungary's official national legislation database**, the Nemzeti
Jogszabalytar (NJT, `njt.jog.gov.hu`), maintained by MKIFK. It gives an AI agent a piece of
Hungarian legislation resolved by its **native ELI** (European Legislation Identifier), with a
verifiable citation: the ELI itself, a human-readable citation, and a link to the official
source.

Part of the **eu-legal-mcp** line by [MateMatic](https://matematic.co) — one connector per EU
member state, the same citation contract everywhere.

> **On ELI.** Unlike the Netherlands and Sweden (earlier connectors in this line, neither of
> which publishes native ELI), **Hungary has a genuine, documented national ELI
> implementation since 2023** (`njt.jog.gov.hu/eli/urisemak`). `eli_uri` is therefore the real
> `/eli/` URI the tool resolved — never a substitute identifier. See `DISCOVERY.md`.

## Tools

| Tool | What it does |
|---|---|
| `hu_get_act(year, serial)` | Metadata for a Hungarian Act (torveny) by ELI, e.g. year `2013`, serial `5` (the Civil Code). No issuer code needed. |
| `hu_get_legislation(doc_type, year, issuer, serial)` | Metadata for any other legislation (decrees etc.) by ELI — type, year, issuer (case-sensitive) and serial. |
| `hu_get_text(doc_type, year, serial, issuer=None)` | The full document HTML content for either an Act or other legislation. |
| `hu_list_doc_types()` | Valid NJT document-type codes (e.g. `TV`=Act, `R`=decree). |
| `hu_list_issuers()` | Valid NJT issuer codes (e.g. `Korm`=Government) — note the exact casing matters. |
| `hu_coverage()` | Declare what this connector covers, when each family was captured, and - explicitly - what it does NOT cover. Every gap carries a fallback. |

Every response carries the **citation contract**:

- `eli_uri` — the native ELI URI resolved, e.g. `https://njt.jog.gov.hu/eli/TV/2013/5`.
- `human_readable_citation` — built from the parsed title + subtitle, e.g.
  *"2013. évi V. törvény (a Polgári Törvénykönyvről)"*.
- `source_url` — the browsable `njt.jog.gov.hu/jogszabaly/...` document page.

### No free-text search

NJT has no REST/JSON API and its search/browse UI is a JavaScript SPA requiring a session
(not usable headlessly). Documents must be addressed by a **known ELI** — use
`hu_list_doc_types` / `hu_list_issuers` to discover valid codes, then `hu_get_act` /
`hu_get_legislation`. An unresolvable ELI (wrong year/serial/issuer, or wrong issuer-code
case) surfaces as `not_found` — NJT itself redirects it to a search-assist page rather than
a 404.

## Install

```bash
pip install -e ".[dev]"
```

Register it with your MCP client (see `.mcp.json.example`):

```json
{
  "mcpServers": {
    "hu-eli-mcp": {
      "command": "hu-eli-mcp",
      "env": {
        "HU_ELI_BASE_URL": "https://njt.jog.gov.hu",
        "HU_ELI_CACHE_DIR": "~/.matematic/cache/hu-eli",
        "HU_ELI_AUDIT_DIR": "~/.matematic/audit"
      }
    }
  }
}
```

### Windows 11 with Smart App Control

Smart App Control blocks unsigned executables, which covers `uvx.exe`, `pip.exe`
and the `hu-eli-mcp.exe` launcher that pip writes at install time. The `python.exe` and
`py.exe` from the python.org installer are signed by the Python Software
Foundation, so running the module through the interpreter works:

```bash
python -m pip install hu-eli-mcp
python -m hu_eli_mcp
```

`pip.exe` is blocked for the same reason, so install with `python -m pip`, not
`pip install`. If `python` is not on PATH, use the Windows launcher: `py -3 -m hu_eli_mcp`.

```json
{ "mcpServers": { "hu-eli-mcp": { "command": "python", "args": ["-m", "hu_eli_mcp"] } } }
```

Do not turn Smart App Control off to work around this - it cannot be re-enabled
without reinstalling Windows.

## Design

- **Public data only.** Read-only against the keyless, official `njt.jog.gov.hu`; nothing is
  sent beyond the ELI path being resolved. Honors `robots.txt` (never calls `/search/*`).
- **Audit log.** Every call appends one JSON line to `~/.matematic/audit/hu-eli-mcp.jsonl`
  (AI Act art. 12 record-keeping).
- **Vendor-neutral.** No LLM provider, no telemetry; own backoff + on-disk cache.
- **No fabrication.** The ELI, title and citation are parsed from the resolved document page.
  If NJT's markup changes, the connector fails loudly rather than returning stale or invented
  data.

See `CONSTITUTION.md` (the 4 principles) and `DISCOVERY.md` (how the source was mapped,
including the `njt.hu` → `njt.jog.gov.hu` domain discovery and the issuer-code casing gotcha).

## Tests

```bash
pytest tests/test_instructions_drift.py   # offline
pytest tests/test_smoke.py                 # live NJT
```

## Licence

Apache-2.0. The Hungarian legislation served is official public data of Hungary; this
connector adds no rights over it.
elihungarylawlegaltechmcpmcp-servermodel-context-protocol

What people ask about hu-eli-mcp

What is matematicsolutions/hu-eli-mcp?

+

matematicsolutions/hu-eli-mcp is mcp servers for the Claude AI ecosystem. MCP connector for Hungarian legislation (Nemzeti Jogszabalytar) via structured retrieval It has 0 GitHub stars and its last recorded update is dated 2026-08-24.

How do I install hu-eli-mcp?

+

You can install hu-eli-mcp by cloning the repository (https://github.com/matematicsolutions/hu-eli-mcp) or following the README instructions on GitHub. ClaudeWave also provides quick install blocks on this page.

Is matematicsolutions/hu-eli-mcp safe to use?

+

Our security agent has analyzed matematicsolutions/hu-eli-mcp and assigned a Trust Score of 95/100 (tier: Verified). See the full breakdown of passed checks and flags on this page.

Who maintains matematicsolutions/hu-eli-mcp?

+

matematicsolutions/hu-eli-mcp is maintained by matematicsolutions. The last recorded GitHub activity is dated 2026-08-24, with 0 open issues.

Are there alternatives to hu-eli-mcp?

+

Yes. On ClaudeWave you can browse similar mcp servers at /categories/mcp, sorted by popularity or recent activity.

Deploy hu-eli-mcp to your cloud

Ship this repo to production in minutes. Each platform spins up its own environment with editable env vars.

Maintain this repo? Add a badge to your README

Drop the badge into your GitHub README to show it's tracked on ClaudeWave. Each badge links back to this page and reflects the live Trust Score.

Featured on ClaudeWave: matematicsolutions/hu-eli-mcp
[![Featured on ClaudeWave](https://claudewave.com/api/badge/matematicsolutions-hu-eli-mcp)](https://claudewave.com/repo/matematicsolutions-hu-eli-mcp)
<a href="https://claudewave.com/repo/matematicsolutions-hu-eli-mcp"><img src="https://claudewave.com/api/badge/matematicsolutions-hu-eli-mcp" alt="Featured on ClaudeWave: matematicsolutions/hu-eli-mcp" width="320" height="64" /></a>

More MCP Servers

hu-eli-mcp alternatives